PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10040684
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 342aa    MW: 37693.9 Da    PI: 9.9763
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10040684genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-174389148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT++Ed +l+++vkq+G + W+ Ia+++  gR +kqc++rw+++l
      Lus10040684 43 KGQWTEDEDRKLIRLVKQFGIRKWAEIAQRLS-GRAGKQCRERWHNHL 89
                     799*****************************.*************97 PP

2Myb_DNA-binding51.91.7e-1697137345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       W++eE+ + vda+++ G++ W+ Ia+ ++ gRt++ +k++w+
      Lus10040684  97 GWSEEEERIMVDAHAKIGNR-WAEIAKLIP-GRTENAIKNHWN 137
                      6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.3843893IPR017930Myb domain
SuperFamilySSF466897.55E-3041136IPR009057Homeodomain-like
SMARTSM007171.1E-154291IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-274497IPR009057Homeodomain-like
CDDcd001673.38E-154689No hitNo description
PfamPF139213.4E-1846103No hitNo description
PROSITE profilePS5129418.30394144IPR017930Myb domain
SMARTSM007174.0E-1494142IPR001005SANT/Myb domain
CDDcd001673.45E-1198140No hitNo description
Gene3DG3DSA:1.10.10.606.6E-2098142IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MRNRNPNDVA AAREGTMKKK KNTNKGSVVV KKRQSSCYAA LIKGQWTEDE DRKLIRLVKQ  60
FGIRKWAEIA QRLSGRAGKQ CRERWHNHLR PDIKKEGWSE EEERIMVDAH AKIGNRWAEI  120
AKLIPGRTEN AIKNHWNATK RRQNSRRKHP KSKSTEASTN VTNGAVKPQS SSSSILQDYI  180
RSKTLQLNQQ PNTTSATPSS TSSRGDGDGD GGSLLPSLSE SDEELLFMQN LFASKPSDAG  240
HVDDSNGRDQ PGFINAGGMI VRDCSHHAAT SSRHGHHHLY SDLYVSYLLN GGASYASSSA  300
SCDADKAEDG GMVSLEMIDH RHGGSNKKEM DLIEMLSSTA S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-46411432104C-Myb DNA-Binding Domain
1mse_C1e-46411432104C-Myb DNA-Binding Domain
1gv2_A2e-46411432104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00567DAPTransfer from AT5G58850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1744460.0JX174446.1 Linum usitatissimum clone LuBAC375M9, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011035335.12e-89PREDICTED: transcription factor MYB98-like
TrEMBLI6XCR30.0I6XCR3_LINUS; Myb-like DNA-binding domain protein
STRINGPOPTR_0001s25710.15e-88(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41293158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.17e-73myb domain protein 119